Loading...
Statistics
Advertisement

Fh-knowthefacts.com

Advertisement
Conversion Technology Metas Server
Fh-knowthefacts.com is hosted in Ireland / Dublin . Fh-knowthefacts.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Javascript, Number of used javascripts: 8. First javascripts: Jquery.min.js, Jquery.validate.min.js, Additional-methods.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Fh-knowthefacts.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Javascript
  • jQuery Validate

Advertisement

Javascripts

Number of occurences: 8
  • jquery.min.js
  • jquery.validate.min.js
  • additional-methods.js
  • jquery.ubpoverlay.js
  • main.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Powered by

  • Page Server II 2.1.79 39a8f25

CDN

Number of occurences: 1
  • CloudFront

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Fh-knowthefacts.com

Missing HTTPS protocol.

    Meta - Fh-knowthefacts.com

    Number of occurences: 3
    • Name:
      Content: text/html; charset=UTF-8
    • Name: keywords
      Content:
    • Name: description
      Content:

    Server / Hosting

    • IP: 52.49.44.153
    • Latitude: 53.34
    • Longitude: -6.26
    • Country: Ireland
    • City: Dublin

    Rname

    • fhdns.flhosp.org
    • fhdns2.flhosp.org
    • mx1.fhmis.net
    • mx2.fhmis.net
    • mx3.fhmis.net

    Target

    • www.fh-knowthefacts.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Wed, 27 Apr 2016 05:42:08 GMT Server: Apache Location: http://www.fh-knowthefacts.com/ Connection: close Content-Type: text/html; charset=iso-8859-1 HTTP/1.1 200 OK Content-Location: http://www.fh-knowthefacts.com/ Content-Type: text/html; charset=UTF-8 Date: Wed, 27 Apr 2016 05:42:08 GMT ETag: 698a74e02d927ff3203e821265cbbf80 Last-Modified: Mon, 18 Mar 2013 12:55:50 GMT Link: ; rel="canonical" P3P: CP="This is not a privacy policy." Set-Cookie: ubpv=a%2Cdc8fcd1e-3887-11e1-a106-12313e003132; Expires=Fri, 28 Oct 2016 05:42:08 GMT; Path=/ Set-Cookie: ubvt=176.9.124.81462457442984928; Expires=Sat, 30 Apr 2016 05:42:08 GMT; Path=/; Domain=fh-knowthefacts.com Set-Cookie: ubvs=176.9.124.81462457442984928; Expires=Mon, 24 Oct 2016 05:42:08 GMT; Path=/ X-Powered-By: Page Server II 2.1.79 39a8f25 X-Server-Instance: ps2-c279e548.eu-west-1.unbounce.net X-Unbounce-PageId: dc8fcd1e-3887-11e1-a106-12313e003132 X-Unbounce-Variant: a X-Unbounce-VisitorID: 176.9.124.81462457442984928 Connection: keep-alive

    DNS

    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: A
    4. ip: 204.4.13.54
    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: fhdns.flhosp.org
    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: NS
    4. target: fhdns2.flhosp.org
    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: SOA
    4. mname: fhdns.flhosp.org
    5. rname: www.fh-knowthefacts.com
    6. serial: 2012012300
    7. refresh: 3600
    8. retry: 1200
    9. expire: 86400
    10. minimum-ttl: 1800
    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: mx1.fhmis.net
    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: mx2.fhmis.net
    host: fh-knowthefacts.com
    1. class: IN
    2. ttl: 1800
    3. type: MX
    4. pri: 10
    5. target: mx3.fhmis.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.h-knowthefacts.com, www.fqh-knowthefacts.com, www.qh-knowthefacts.com, www.fh-knowthefacts.com, www.h-knowthefacts.com, www.fah-knowthefacts.com, www.ah-knowthefacts.com, www.fyh-knowthefacts.com, www.yh-knowthefacts.com, www.fth-knowthefacts.com, www.th-knowthefacts.com, www.fgh-knowthefacts.com, www.gh-knowthefacts.com, www.fbh-knowthefacts.com, www.bh-knowthefacts.com, www.fwh-knowthefacts.com, www.wh-knowthefacts.com, www.fsh-knowthefacts.com, www.sh-knowthefacts.com, www.fdh-knowthefacts.com, www.dh-knowthefacts.com, www.frh-knowthefacts.com, www.rh-knowthefacts.com, www.f3h-knowthefacts.com, www.3h-knowthefacts.com, www.f4h-knowthefacts.com, www.4h-knowthefacts.com, www.f-knowthefacts.com, www.fhe-knowthefacts.com, www.fe-knowthefacts.com, www.fhd-knowthefacts.com, www.fd-knowthefacts.com, www.fhc-knowthefacts.com, www.fc-knowthefacts.com, www.fhu-knowthefacts.com, www.fu-knowthefacts.com, www.fhj-knowthefacts.com, www.fj-knowthefacts.com, www.fh-knowthefacts.com, www.f-knowthefacts.com, www.fhb-knowthefacts.com, www.fb-knowthefacts.com, www.fhg-knowthefacts.com, www.fg-knowthefacts.com, www.fhknowthefacts.com, www.fh-tknowthefacts.com, www.fhtknowthefacts.com, www.fh-gknowthefacts.com, www.fhgknowthefacts.com, www.fh-hknowthefacts.com, www.fhhknowthefacts.com, www.fh-uknowthefacts.com, www.fhuknowthefacts.com, www.fh-jknowthefacts.com, www.fhjknowthefacts.com, www.fh-xknowthefacts.com, www.fhxknowthefacts.com, www.fh-sknowthefacts.com, www.fhsknowthefacts.com, www.fh-aknowthefacts.com, www.fhaknowthefacts.com, www.fh-knowthefacts.com, www.fhknowthefacts.com, www.fh- knowthefacts.com, www.fh knowthefacts.com, www.fh-nowthefacts.com, www.fh-ktnowthefacts.com, www.fh-tnowthefacts.com, www.fh-knowthefacts.com, www.fh-nowthefacts.com, www.fh-kgnowthefacts.com, www.fh-gnowthefacts.com, www.fh-kbnowthefacts.com, www.fh-bnowthefacts.com, www.fh-knnowthefacts.com, www.fh-nnowthefacts.com, www.fh-khnowthefacts.com, www.fh-hnowthefacts.com, www.fh-kynowthefacts.com, www.fh-ynowthefacts.com, www.fh-klnowthefacts.com, www.fh-lnowthefacts.com, www.fh-konowthefacts.com, www.fh-onowthefacts.com, www.fh-kunowthefacts.com, www.fh-unowthefacts.com, www.fh-kinowthefacts.com, www.fh-inowthefacts.com, www.fh-kmnowthefacts.com, www.fh-mnowthefacts.com, www.fh-kowthefacts.com, www.fh-knnowthefacts.com, www.fh-knowthefacts.com, www.fh-knhowthefacts.com, www.fh-khowthefacts.com, www.fh-knjowthefacts.com, www.fh-kjowthefacts.com, www.fh-knkowthefacts.com, www.fh-kkowthefacts.com, www.fh-knlowthefacts.com, www.fh-klowthefacts.com, www.fh-kn owthefacts.com, www.fh-k owthefacts.com, www.fh-knwthefacts.com, www.fh-knobwthefacts.com, www.fh-knbwthefacts.com, www.fh-knohwthefacts.com, www.fh-knhwthefacts.com, www.fh-knogwthefacts.com, www.fh-kngwthefacts.com, www.fh-knojwthefacts.com, www.fh-knjwthefacts.com, www.fh-knomwthefacts.com, www.fh-knmwthefacts.com, www.fh-kno wthefacts.com, www.fh-kn wthefacts.com, www.fh-knovwthefacts.com, www.fh-knvwthefacts.com, www.fh-knothefacts.com, www.fh-know thefacts.com, www.fh-kno thefacts.com, www.fh-knowcthefacts.com, www.fh-knocthefacts.com, www.fh-knowthefacts.com, www.fh-knothefacts.com, www.fh-knowdthefacts.com, www.fh-knodthefacts.com, www.fh-knowfthefacts.com, www.fh-knofthefacts.com, www.fh-knowgthefacts.com, www.fh-knogthefacts.com, www.fh-knowbthefacts.com, www.fh-knobthefacts.com, www.fh-knowhefacts.com, www.fh-knowtqhefacts.com, www.fh-knowqhefacts.com, www.fh-knowtahefacts.com, www.fh-knowahefacts.com, www.fh-knowt hefacts.com, www.fh-know hefacts.com, www.fh-knowtwhefacts.com, www.fh-knowwhefacts.com, www.fh-knowtehefacts.com, www.fh-knowehefacts.com, www.fh-knowtzhefacts.com, www.fh-knowzhefacts.com, www.fh-knowtxhefacts.com, www.fh-knowxhefacts.com, www.fh-knowtchefacts.com, www.fh-knowchefacts.com, www.fh-knowtefacts.com, www.fh-knowtheefacts.com, www.fh-knowteefacts.com, www.fh-knowthdefacts.com, www.fh-knowtdefacts.com, www.fh-knowthcefacts.com, www.fh-knowtcefacts.com, www.fh-knowthuefacts.com, www.fh-knowtuefacts.com, www.fh-knowthjefacts.com, www.fh-knowtjefacts.com, www.fh-knowthefacts.com, www.fh-knowtefacts.com, www.fh-knowthbefacts.com, www.fh-knowtbefacts.com, www.fh-knowthgefacts.com, www.fh-knowtgefacts.com,

    Other websites we recently analyzed

    1. ifashion
      ifashion
      Lithuania - 79.98.25.28
      G Analytics ID: UA-53267986-1
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery Cookie, jQuery UI, Php, Google Analytics
      Number of Javascript: 11
      Number of meta tags: 4
    2. Home - ATER Viterbo
      Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
      Arezzo (Italy) - 62.149.142.90
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Joomla
      Number of Javascript: 7
      Number of meta tags: 4
    3. tuckerbicycle
      Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    4. Lehigh Cottage
      Scottsdale (United States) - 97.74.141.128
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery
      Number of Javascript: 4
      Number of meta tags: 4
    5. MK MEDIA - Интернет-маркетинг
      MK MEDIA - Интернет-маркетинг
      Russian Federation - 77.222.56.94
      Server software: nginx/1.9.12
      Technology: CSS, Html, Html5, Javascript, LiveInternet counter
      Number of Javascript: 1
      Number of meta tags: 4
    6. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Google Adsense, CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    7. Home
      Brea (United States) - 69.163.144.16
      Server software: Apache
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 2
    8. Trakehner France - Association Française du Trakehner
      Trakehner France - Site officiel de AFT - Association Française du Trakehner - Histoire - Chevaux - Elevages - Trakehner Frankreich
      United States - 159.100.190.4
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 7
      Number of meta tags: 10
    9. jesusair.org
      Scottsdale (United States) - 50.63.202.55
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. Eye 2 Eye Support group for the blind, legally blind, and Deaf in Yale Michigan
      Eye 2 Eye Support group for the blind, legally blind, and Deaf in Yale Michigan
      Houston (United States) - 192.185.185.70
      Server software: nginx/1.10.1
      Technology: CSS, Html, Javascript
      Number of meta tags: 3

    Check Other Websites